PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G060800.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 208aa    MW: 22622.6 Da    PI: 9.4626
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G060800.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.12.1e-2597141145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        ++epgrCrRtDGKkWRC ++v++++k+CErH+hrgr+rsrk++e+
  Aqcoe7G060800.3.p  97 EPEPGRCRRTDGKKWRCAKDVVPDQKYCERHMHRGRNRSRKHVEN 141
                        69****************************************997 PP

2QLQ60.45.1e-213167137
                QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                       s FT  Qlq+L++Q+l+yKy+aa+ PvP++L+++i+k
  Aqcoe7G060800.3.p 31 STFTFLQLQELEHQALIYKYMAAGIPVPSHLVLPIWK 67
                       67**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-103167IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9313267IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.8E-153366IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.24897141IPR014977WRC domain
PfamPF088798.6E-2298140IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGTDEGGERK VVTSVGLDLG LGSNTIKHGK STFTFLQLQE LEHQALIYKY MAAGIPVPSH  60
LVLPIWKSLG NTYAGTGIYP TFLGCRGVCF DYRNSMEPEP GRCRRTDGKK WRCAKDVVPD  120
QKYCERHMHR GRNRSRKHVE NTSTQTVTIA SSSPSSNSTN VSVPFQLMSS TPTTTISTNS  180
IVSSGMGLSP NSVLQENGAF KTETSSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276023.12e-66PREDICTED: growth-regulating factor 10
SwissprotQ6EPP93e-54GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLM0TPQ99e-66M0TPQ9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P12060_0013e-65(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.16e-38growth-regulating factor 2